PDB entry 1uds

View 1uds on RCSB PDB site
Description: Crystal structure of the tRNA processing enzyme RNase PH R126A mutant from Aquifex aeolicus
Class: transferase
Keywords: transferase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-05-02, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease PH
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67069 (Start-254)
      • engineered (125)
    Domains in SCOPe 2.07: d1udsa1, d1udsa2
  • Heterogens: PO4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1udsA (A:)
    mrsdgrkedqlrpvsiqrdfleypegsclisfgktkvictasvienvpnwlkgkgqgwit
    aeysmlpratqqrtiresvqgriggrtheiqrmigramrtaveltkigertiwvdcdviq
    adggtataaitgafvavadaiiklhkegiieetpikdfvaavsvgivndrilldlnfeed
    saaqvdmnvvgtgsgrlsevhtmgeeysftkdelikmldlaqkginelielqkklyviqd
    gkwerselkevsstt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udsA (A:)
    rsdgrkedqlrpvsiqrdfleypegsclisfgktkvictasvienvpnwlkgkgqgwita
    eysmlpratqqrtiresvqgriggrtheiqrmigramrtaveltkigertiwvdcdviqa
    dggtataaitgafvavadaiiklhkegiieetpikdfvaavsvgivndrilldlnfeeds
    aaqvdmnvvgtgsgrlsevhtmgeeysftkdelikmldlaqkginelielqkklyviqdg
    kwerselkevsstt