PDB entry 1udr

View 1udr on RCSB PDB site
Description: chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4)
Class: chemotaxis
Keywords: chemotaxis, phosphoryl transfer, signal transduction
Deposited on 1996-11-05, released 1997-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chey protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (Start-128)
      • engineered (90-91)
      • engineered (95)
      • engineered (97)
    Domains in SCOPe 2.07: d1udra_
  • Chain 'B':
    Compound: chey protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (Start-128)
      • engineered (90-91)
      • engineered (95)
      • engineered (97)
    Domains in SCOPe 2.07: d1udrb_
  • Chain 'C':
    Compound: chey protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (Start-128)
      • engineered (90-91)
      • engineered (95)
      • engineered (97)
    Domains in SCOPe 2.07: d1udrc_
  • Chain 'D':
    Compound: chey protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (Start-128)
      • engineered (90-91)
      • engineered (95)
      • engineered (97)
    Domains in SCOPe 2.07: d1udrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1udrA (A:)
    mrdkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
    pnmdglellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleekl
    nkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udrA (A:)
    kelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnm
    dglellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnki
    feklgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1udrB (B:)
    mrdkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
    pnmdglellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleekl
    nkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udrB (B:)
    elkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
    glellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnkif
    eklgm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1udrC (C:)
    mrdkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
    pnmdglellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleekl
    nkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udrC (C:)
    elkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
    glellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnkif
    eklgm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1udrD (D:)
    mrdkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
    pnmdglellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleekl
    nkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udrD (D:)
    kelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnm
    dglellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnki
    feklgm