PDB entry 1udp

View 1udp on RCSB PDB site
Description: the molecular structure of udp-galactose 4-epimerase from escherichia coli determined at 2.5 angstroms resolution
Deposited on 1992-07-20, released 1993-10-31
The last revision was dated 1993-10-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.184
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1udpA (A:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1udpB (B:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd