PDB entry 1udm

View 1udm on RCSB PDB site
Description: Solution structure of Coactosin-like protein (Cofilin family) from Mus Musculus
Class: protein binding
Keywords: Actin binding protein, cytoskeletal, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, PROTEIN BINDING
Deposited on 2003-05-01, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Coactosin-like protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2010004C08
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9CQI6 (7-148)
    • cloning artifact (0-6)
  Domains in SCOPe 2.06: d1udma1, d1udma2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1udmA (A:)
  gsegaatmatkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqct
  ddvrlfafvrfttgdamskrskfalitwigedvsglqraktgtdktlvkevvqnfakefv
  isdrkeleedfirselkkagganydaqse