PDB entry 1udm

View 1udm on RCSB PDB site
Description: solution structure of coactosin-like protein (cofilin family) from mus musculus
Deposited on 2003-05-01, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1udma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1udmA (A:)
gsegaatmatkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqct
ddvrlfafvrfttgdamskrskfalitwigedvsglqraktgtdktlvkevvqnfakefv
isdrkeleedfirselkkagganydaqse