PDB entry 1udl

View 1udl on RCSB PDB site
Description: The solution structure of the fifth SH3 domain of intersectin 2 (KIAA1256)
Class: endocytosis/exocytosis
Keywords: BETA BARREL, SH3 DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2003-05-01, released 2003-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Intersectin 2
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA hh15293
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NZM3 (7-91)
    • cloning artifact (0-6)
    • cloning artifact (92-97)
  Domains in SCOPe 2.07: d1udla1, d1udla2, d1udla3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1udlA (A:)
  gssgssgqkgwfpashvkllgpsseratpafhpvcqviamydyaannedelsfskgqlin
  vmnkddpdwwqgeingvtglfpsnyvkmttdssgpssg