PDB entry 1udl

View 1udl on RCSB PDB site
Description: The solution structure of the fifth SH3 domain of intersectin 2 (KIAA1256)
Class: endocytosis/exocytosis
Keywords: BETA BARREL, SH3 DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2003-05-01, released 2003-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intersectin 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA hh15293
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZM3 (7-91)
      • cloning artifact (0-6)
      • cloning artifact (92-97)
    Domains in SCOPe 2.06: d1udla1, d1udla2, d1udla3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1udlA (A:)
    gssgssgqkgwfpashvkllgpsseratpafhpvcqviamydyaannedelsfskgqlin
    vmnkddpdwwqgeingvtglfpsnyvkmttdssgpssg