PDB entry 1udl

View 1udl on RCSB PDB site
Description: the solution structure of the fifth sh3 domain of intersectin 2 (kiaa1256)
Deposited on 2003-05-01, released 2003-11-01
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-01, with a file datestamp of 2003-11-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1udla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1udlA (A:)
    gssgssgqkgwfpashvkllgpsseratpafhpvcqviamydyaannedelsfskgqlin
    vmnkddpdwwqgeingvtglfpsnyvkmttdssgpssg