PDB entry 1udi

View 1udi on RCSB PDB site
Description: nucleotide mimicry in the crystal structure of the uracil-DNA glycosylase-uracil glycosylase inhibitor protein complex
Class: hydrolase/inhibitor
Keywords: HYDROLASE/INHIBITOR complex
Deposited on 1995-10-30, released 1996-03-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.188
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: uracil-DNA glycosylase
    Species: HERPES SIMPLEX VIRUS (TYPE 1 / STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1udie_
  • Chain 'I':
    Compound: uracil-DNA glycosylase inhibitor protein
    Species: Bacillus phage PBS1 [TaxId:10683]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1udii_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1udiE (E:)
    mdltnggvspaatsapldwttfrrvfliddawrplmepelanpltahllaeynrrcqtee
    vlppredvfswtryctpdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaav
    kncypearmsghgclekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarr
    pglvfmlwgthaqnairpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispi
    dwsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udiE (E:)
    dwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryctp
    devrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgclek
    wardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnair
    pdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1udiI (I:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml