PDB entry 1udh

View 1udh on RCSB PDB site
Description: the structural basis of specific base excision repair by uracil-DNA glycosylase
Class: hydrolase
Keywords: hydrolase, DNA-n-glycosidase
Deposited on 1995-10-30, released 1996-03-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: HERPES SIMPLEX VIRUS (TYPE 1 / STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1udha_
  • Heterogens: SO4, URA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1udhA (A:)
    mdltnggvspaatsapldwttfrrvfliddawrplmepelanpltahllaeynrrcqtee
    vlppredvfswtryctpdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaav
    kncypearmsghgclekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarr
    pglvfmlwgthaqnairpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispi
    dwsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udhA (A:)
    ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
    pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
    kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
    rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv