PDB entry 1udh

View 1udh on RCSB PDB site
Description: the structural basis of specific base excision repair by uracil-dna glycosylase
Deposited on 1995-10-30, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1udh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1udh_ (-)
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv