PDB entry 1udc

View 1udc on RCSB PDB site
Description: structure of udp-galactose-4-epimerase complexed with udp-mannose
Class: isomerase
Keywords: udp-galactose, epimerase, isomerase
Deposited on 1997-01-06, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.177
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactose-4-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1udca_
  • Heterogens: NA, NAD, UFM, PGE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1udcA (A:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd