PDB entry 1ud9

View 1ud9 on RCSB PDB site
Description: Crystal Structure of Proliferating Cell Nuclear Antigen (PCNA) Homolog From Sulfolobus tokodaii
Deposited on 2003-04-28, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ud9A (A:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vpevnlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdt
    gsladiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyll
    apkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud9A (A:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vplefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsl
    adiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapk
    ls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ud9B (B:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vpevnlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdt
    gsladiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyll
    apkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud9B (B:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    fdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsladie
    fnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapkls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ud9C (C:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vpevnlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdt
    gsladiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyll
    apkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud9C (C:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppl
    efdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsladi
    efnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapkls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ud9D (D:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vpevnlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdt
    gsladiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyll
    apkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud9D (D:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppv
    nlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsla
    diefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapkl
    s