PDB entry 1ud9

View 1ud9 on RCSB PDB site
Description: Crystal Structure of Proliferating Cell Nuclear Antigen (PCNA) Homolog From Sulfolobus tokodaii
Class: DNA binding protein
Keywords: DNA-binding, DNA replication, DNA binding protein
Deposited on 2003-04-28, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.202
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase sliding clamp A
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q975N2 (1-244)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1ud9a1, d1ud9a2
  • Chain 'B':
    Compound: DNA polymerase sliding clamp A
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q975N2 (1-244)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1ud9b1, d1ud9b2
  • Chain 'C':
    Compound: DNA polymerase sliding clamp A
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q975N2 (1-244)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1ud9c1, d1ud9c2
  • Chain 'D':
    Compound: DNA polymerase sliding clamp A
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q975N2 (1-244)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1ud9d1, d1ud9d2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ud9A (A:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vpevnlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdt
    gsladiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyll
    apkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud9A (A:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vplefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsl
    adiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapk
    ls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ud9B (B:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vpevnlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdt
    gsladiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyll
    apkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud9B (B:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    fdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsladie
    fnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapkls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ud9C (C:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vpevnlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdt
    gsladiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyll
    apkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud9C (C:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppl
    efdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsladi
    efnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapkls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ud9D (D:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppe
    vpevnlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdt
    gsladiefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyll
    apkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud9D (D:)
    ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
    vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlppv
    nlefdikatinasglknaigeiaevadtllisgneekvvvkgegenkvevefskdtgsla
    diefnkesssaydveylndiisltklsdyvkvafadqkpmqlefnmegggkvtyllapkl
    s