PDB entry 1ud7

View 1ud7 on RCSB PDB site
Description: solution structure of the designed hydrophobic core mutant of ubiquitin, 1d7
Class: ubiquitin
Keywords: ubiquitin, designed core mutant
Deposited on 1999-04-07, released 1999-05-06
The last revision prior to the SCOP 1.75 freeze date was dated 1999-08-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (ubiquitin core mutant 1d7)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02248 (0-75)
    • engineered (2)
    • engineered (4)
    • engineered (12)
    • engineered (14)
    • engineered (22)
    • engineered (25)
    • engineered (66)
  Domains in SCOP 1.75: d1ud7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ud7A (A:)
  mqvflktltgktvtievepsdtvenfkakiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestihlvlrlrgg