PDB entry 1ud3

View 1ud3 on RCSB PDB site
Description: Crystal structure of AmyK38 N289H mutant
Class: hydrolase
Keywords: calcium-free, alkaline, alpha-amylase, hydrolase
Deposited on 2003-04-28, released 2003-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.233
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylase
    Species: Bacillus sp. KSM-K38 [TaxId:129736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93I48 (0-479)
      • engineered (288)
    Domains in SCOPe 2.07: d1ud3a1, d1ud3a2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ud3A (A:)
    dglngtmmqyyewhlendgqhwnrlhddaaalsdagitaiwippaykgnsqadvgygayd
    lydlgefnqkgtvrtkygtkaqleraigslksndinvygdvvmnhkmgadfteavqavqv
    nptnrwqdisgaytidawtgfdfsgrnnaysdfkwrwfhfngvdwdqryqenhifrfant
    nwnwrvdeengnydyllgsnidfshpevqdelkdwgswftdeldldgyrldaikhipfwy
    tsdwvrhqrneadqdlfvvgeywkddvgalefyldemnwemslfdvplhynfyrasqqgg
    sydmrnilrgslveahpmhavtfvdnhdtqpgesleswvadwfkplayatiltreggypn
    vfygdyygipndnisakkdmidelldarqnyaygtqhdyfdhwdvvgwtregsssrpnsg
    latimsngpggskwmyvgrqnagqtwtdltgnngasvtingdgwgefftnggsvsvyvnq