PDB entry 1ud0

View 1ud0 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF THE C-TERMINAL 10-kDA SUBDOMAIN OF HSC70
Class: chaperone
Keywords: hsc70, chaperone
Deposited on 2003-04-24, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 3.45 Å
R-factor: 0.249
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 70 kDa heat-shock-like protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63018 (8-End)
      • cloning artifact (3-7)
      • modified residue (15)
      • modified residue (83)
    Domains in SCOPe 2.07: d1ud0a1, d1ud0a2
  • Chain 'B':
    Compound: 70 kDa heat-shock-like protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63018 (8-End)
      • cloning artifact (3-7)
      • modified residue (15)
      • modified residue (83)
    Domains in SCOPe 2.07: d1ud0b1, d1ud0b2
  • Chain 'C':
    Compound: 70 kDa heat-shock-like protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63018 (8-End)
      • cloning artifact (0-7)
      • modified residue (15)
      • modified residue (83)
      • modified residue (87)
    Domains in SCOPe 2.07: d1ud0c1, d1ud0c2
  • Chain 'D':
    Compound: 70 kDa heat-shock-like protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63018 (8-End)
      • cloning artifact (3-7)
      • modified residue (15)
    Domains in SCOPe 2.07: d1ud0d1, d1ud0d2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ud0A (A:)
    lvprgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefe
    hqqkelekvcnpiitklyqsaggmpggmpggfpgggappsggassgptieevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud0A (A:)
    rgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefehqq
    kelekvcnpiitklyqsaggmpgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ud0B (B:)
    lvprgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefe
    hqqkelekvcnpiitklyqsaggmpggmpggfpgggappsggassgptieevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud0B (B:)
    rgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefehqq
    kelekvcnpiitklyqsaggmp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ud0C (C:)
    lvprgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefe
    hqqkelekvcnpiitklyqsaggmpggmpggfpgggappsggassgptieevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud0C (C:)
    lvprgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefe
    hqqkelekvcnpiitklyqsaggmpggm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ud0D (D:)
    lvprgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefe
    hqqkelekvcnpiitklyqsaggmpggmpggfpgggappsggassgptieevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ud0D (D:)
    rgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefehqq
    kelekvcnpiitklyqsa