PDB entry 1ucz

View 1ucz on RCSB PDB site
Description: ubiquitin conjugating enzyme (ubc7) from saccharomyces cerevisiae
Deposited on 1996-11-07, released 1997-05-15
The last revision was dated 1997-05-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.93 Å
R-factor: 0.183
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1ucz_ (-)
    msktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklef
    pkdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekil
    lsvmsmlsepniesganidacilwrdnrpeferqvklsilkslgf
    

    Sequence, based on observed residues (ATOM records):
    >1ucz_ (-)
    ktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefpk
    dyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekills
    vmsmlsepniesganidacilwrdnrpeferqvklsilkslgf
    

  • Chain 'p':
    No sequence available.