PDB entry 1ucv

View 1ucv on RCSB PDB site
Description: Sterile alpha motif (SAM) domain of ephrin type-A receptor 8
Class: transferase
Keywords: RECEPTOR OLIGOMERIZATION, DEVELOPMENTAL REGULATION, TYROSINE KINASE, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-04-23, released 2004-05-11
The last revision prior to the SCOP 1.75 freeze date was dated 2004-05-11, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephrin type-a receptor 8
    Species: HOMO SAPIENS
    Gene: KAZUSA cDNA fh16961
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29322 (7-74)
      • cloning artifact (0-6)
      • cloning artifact (75-80)
    Domains in SCOP 1.75: d1ucva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucvA (A:)
    gssgssgltvgdwldsirmgryrdhfaaggysslgmvlrmnaqdvralgitlmghqkkil
    gsiqtmraqltstqgsgpssg