PDB entry 1ucv

View 1ucv on RCSB PDB site
Description: sterile alpha motif (sam) domain of ephrin type-a receptor 8
Deposited on 2003-04-23, released 2004-05-11
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ucva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucvA (A:)
    gssgssgltvgdwldsirmgryrdhfaaggysslgmvlrmnaqdvralgitlmghqkkil
    gsiqtmraqltstqgsgpssg