PDB entry 1ucu

View 1ucu on RCSB PDB site
Description: R-type straight flagellar filament made of full-length flagellin
Class: Structural protein
Keywords: FLAGELLIN, FLAGELLAR FILAMENT, CRYO-ELECTRON MICROSCOPY, HELICAL RECONSTRUCTION, Structural protein
Deposited on 2003-04-22, released 2003-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 4 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phase 1 flagellin
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06179 (0-493)
      • see remark 999 (448)
    Domains in SCOPe 2.07: d1ucua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucuA (A:)
    aqvintnslslltqnnlnksqsalgtaierlssglrinsakddaagqaianrftanikgl
    tqasrnandgisiaqttegalneinnnlqrvrelavqsanstnsqsdldsiqaeitqrln
    eidrvsgqtqfngvkvlaqdntltiqvgandgetididlkqinsqtlgldtlnvqqkykv
    sdtaatvtgyadttialdnstfkasatglggtdqkidgdlkfddttgkyyakvtvtggtg
    kdgyyevsvdktngevtlaggatspltgglpatatedvknvqvanadlteakaaltaagv
    tgtasvvkmsytdnngktidgglavkvgddyysatqnkdgsisinttkytaddgtsktal
    nklggadgktevvsiggktyaaskaeghnfkaqpdlaeaaatttenplqkidaalaqvdt
    lrsdlgavqnrfnsaitnlgntvnnltsvrsriedsdyatevsnmsraqilqqagtsvla
    qanqvpqnvlsllr