PDB entry 1uct

View 1uct on RCSB PDB site
Description: Crystal structure of the extracellular fragment of Fc alpha Receptor I (CD89)
Deposited on 2003-04-21, released 2003-07-22
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uctA (A:)
    maqegdfpmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwn
    etdpefvidhmdankagryqcqyrighyrfrysdtlelvvtglygkpflsadrglvlmpg
    enisltcssahipfdrfslakegelslpqhqsgehpanfslgpvdlnvsgiyrcygwynr
    spylwsfpsnalelvvtdsihqdyttqnlilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uctA (A:)
    qegdfpmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlktdpef
    vidhmdankagryqcqyrighyrfrysdtlelvvtglygkpflsadrglvlmpgenislt
    cssahipfdrfslakegelslpqhqsgehpanfslgpvdlnvsgiyrcygwynrspylws
    fpsnalelvvt