PDB entry 1ucr

View 1ucr on RCSB PDB site
Description: Three-dimensional crystal structure of dissimilatory sulfite reductase D (DsrD)
Deposited on 2003-04-18, released 2003-10-14
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-14, with a file datestamp of 2003-10-14.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.139
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ucra_
  • Chain 'B':
    Domains in SCOP 1.69: d1ucrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ucrA (A:)
    meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
    tmyglkgagkqaaaehed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucrA (A:)
    meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
    tmyglkgagkqaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ucrB (B:)
    meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
    tmyglkgagkqaaaehed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucrB (B:)
    meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
    tmyglkgagkqaaae