PDB entry 1ucp

View 1ucp on RCSB PDB site
Description: NMR structure of the PYRIN domain of human ASC
Class: apoptosis
Keywords: death domain fold, apoptosis
Deposited on 2003-04-16, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis-associated speck-like protein containing a CARD
    Species: Homo sapiens [TaxId:9606]
    Gene: ASC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ucpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucpA (A:)
    mgrardaildalenltaeelkkfklkllsvplregygriprgallsmdaldltdklvsfy
    letygaeltanvlrdmglqemagqlqaathq