PDB entry 1ucn

View 1ucn on RCSB PDB site
Description: X-ray structure of human nucleoside diphosphate kinase A complexed with ADP at 2 A resolution
Class: transferase
Keywords: mutant complexe ADP, transferase
Deposited on 2003-04-16, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15531 (Start-151)
      • engineered (59)
      • engineered (117)
    Domains in SCOPe 2.07: d1ucna_
  • Chain 'B':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15531 (Start-151)
      • engineered (59)
      • engineered (117)
    Domains in SCOPe 2.07: d1ucnb_
  • Chain 'C':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15531 (Start-151)
      • engineered (59)
      • engineered (117)
    Domains in SCOPe 2.07: d1ucnc_
  • Heterogens: PO4, CA, ADP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ucnA (A:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpw
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniiggs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucnA (A:)
    ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpwf
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniiggsd
    svesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ucnB (B:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpw
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniiggs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucnB (B:)
    ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpwf
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniiggsd
    svesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ucnC (C:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpw
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniiggs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucnC (C:)
    ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpwf
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniiggsd
    svesaekeiglwfhpeelvdytscaqnwiye