PDB entry 1ucl

View 1ucl on RCSB PDB site
Description: Mutants of RNase Sa
Class: hydrolase
Keywords: Protein Stability, Hydrogen Bond, Burial Polar
Deposited on 2003-04-15, released 2003-09-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.176
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: guanyl-specific ribonuclease sa
  Species: Streptomyces aureofaciens
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
    • engineered (56)
  Domains in SCOP 1.75: d1ucla_
• Chain 'B':
  Compound: guanyl-specific ribonuclease sa
  Species: Streptomyces aureofaciens
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
    • engineered (56)
  Domains in SCOP 1.75: d1uclb_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uclA (A:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheyttitp
  gartrgtrriitgeatqedyytgdhyatfslidqtc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uclB (B:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheyttitp
  gartrgtrriitgeatqedyytgdhyatfslidqtc