PDB entry 1uck

View 1uck on RCSB PDB site
Description: Mutants of RNase Sa
Class: hydrolase
Keywords: Protein Stability, Hydrogen Bond, Burial Polar
Deposited on 2003-04-15, released 2003-09-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered (42)
    Domains in SCOP 1.75: d1ucka_
  • Chain 'B':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered (42)
    Domains in SCOP 1.75: d1uckb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uckA (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnrestlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uckB (B:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnrestlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidqtc