PDB entry 1uck

View 1uck on RCSB PDB site
Description: mutants of rnase sa
Deposited on 2003-04-15, released 2003-09-09
The last revision prior to the SCOP 1.71 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ucka_
  • Chain 'B':
    Domains in SCOP 1.71: d1uckb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uckA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnrestlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uckB (B:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnrestlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc