PDB entry 1uck
View 1uck on RCSB PDB site
Description: Mutants of RNase Sa
Class: hydrolase
Keywords: Protein Stability, Hydrogen Bond, Burial Polar, hydrolase
Deposited on
2003-04-15, released
2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: guanyl-specific ribonuclease sa
Species: Streptomyces aureofaciens [TaxId:1894]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ucka_ - Chain 'B':
Compound: guanyl-specific ribonuclease sa
Species: Streptomyces aureofaciens [TaxId:1894]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1uckb_ - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1uckA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnrestlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1uckB (B:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnrestlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc