PDB entry 1uch

View 1uch on RCSB PDB site
Description: deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom resolution
Class: cysteine protease
Keywords: cysteine protease, deubiquitinating enzyme, ubiquitin, c-terminal hydrolase, ubiquitin conjugation
Deposited on 1997-10-06, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.232
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin c-terminal hydrolase uch-l3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ucha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uchA (A:)
    megqrwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpite
    kyevfrteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlk
    kfleesvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghl
    yeldgrkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uchA (A:)
    rwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekyev
    frteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfle
    esvsmspeerarylenydairvdlhfialvhvdghlyeldgrkpfpinhgetsdetlled
    aievckkfmerdpdelrfnaialsaa