PDB entry 1ucg

View 1ucg on RCSB PDB site
Description: Crystal structure of Ribonuclease MC1 N71T mutant
Class: hydrolase
Keywords: alpha plus beta, hydrolase
Deposited on 2003-04-14, released 2003-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.181
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease MC
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23540 (1-189)
      • initiating met (0)
      • see remark 999 (39)
      • engineered (70)
    Domains in SCOPe 2.08: d1ucga_
  • Chain 'B':
    Compound: Ribonuclease MC
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23540 (1-189)
      • initiating met (0)
      • see remark 999 (39)
      • engineered (70)
    Domains in SCOPe 2.08: d1ucgb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucgA (A:)
    mdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
    lqsqlntlwptvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
    haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct
    rdtcganfif
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucgB (B:)
    mdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
    lqsqlntlwptvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
    haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct
    rdtcganfif