PDB entry 1ucf

View 1ucf on RCSB PDB site
Description: The Crystal Structure of DJ-1, a Protein Related to Male Fertility and Parkinson's Disease
Class: RNA binding protein
Keywords: flavodoxin-like rossmann fold, RNA binding protein
Deposited on 2003-04-11, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: DJ-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ucfa_
  • Chain 'B':
    Compound: RNA-binding protein regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: DJ-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ucfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ucfA (A:)
    maskralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasled
    akkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfg
    skvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaq
    vkaplvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucfA (A:)
    maskralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasled
    akkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfg
    skvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaq
    vkaplvlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ucfB (B:)
    maskralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasled
    akkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfg
    skvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaq
    vkaplvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucfB (B:)
    maskralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasled
    akkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfg
    skvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaq
    vkaplvlk