PDB entry 1ucc

View 1ucc on RCSB PDB site
Description: Crystal structure of the Ribonuclease MC1 from bitter gourd seeds complexed with 3'-UMP.
Deposited on 2003-04-10, released 2003-04-29
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-29, with a file datestamp of 2003-04-29.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.181
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ucca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uccA (A:)
fdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
lqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct
rdtcganfif