PDB entry 1ucb

View 1ucb on RCSB PDB site
Description: structure of uncomplexed fab compared to complex (1cly, 1clz)
Class: immunoglobulin
Keywords: fab, immunoglobulin, antibody, anti-tumor, chimera
Deposited on 1996-02-06, released 1997-03-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric human/mouse igg fab fragment br96
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UCB (0-218)
    Domains in SCOPe 2.03: d1ucbh1, d1ucbh2
  • Chain 'L':
    Compound: chimeric human/mouse igg fab fragment br96
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ucbl1, d1ucbl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucbH (H:)
    evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
    pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsva
    stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ucbL (L:)
    dvlmtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucbL (L:)
    mtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrfsgv
    pdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec