PDB entry 1uca

View 1uca on RCSB PDB site
Description: Crystal structure of the Ribonuclease MC1 from bitter gourd seeds complexed with 2'-UMP
Class: hydrolase
Keywords: alpha plus beta, hydrolase
Deposited on 2003-04-10, released 2003-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.194
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease MC
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23540 (0-189)
      • see remark 999 (39)
    Domains in SCOPe 2.06: d1ucaa_
  • Heterogens: U2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucaA (A:)
    fdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
    lqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
    haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct
    rdtcganfif