PDB entry 1uc9

View 1uc9 on RCSB PDB site
Description: Crystal structure of a lysine biosynthesis enzyme, Lysx, from thermus thermophilus HB8
Deposited on 2003-04-09, released 2003-09-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.243
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uc9A (A:)
    mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
    rglaaaryltalgipvvnrpevieacgdkwatsvalakaglpqpktalatdreealrlme
    afgypvvlkpvigswgrlxxxxxxxxxxxxxxxxkevlggfqhqlfyiqeyvekpgrdir
    vfvvgeraiaaiyrrsahwitntarggqaencplteevarlsvkaaeavgggvvavdlfe
    sergllvnevnhtmefknsvhttgvdipgeilkyawslas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc9A (A:)
    mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
    rglaaaryltalgipvvnrpevieacgdkwatsvalakaglpqpktalatdreealrlme
    afgypvvlkpvigxxxxxxxxxxxxxxxxgfqhqlfyiqeyvekpgrdirvfvvgeraia
    aiyraencplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttg
    vdipgeilkyawslas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uc9B (B:)
    mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
    rglaaaryltalgipvvnrpevieacgdkwatsvalakaglpqpktalatdreealrlme
    afgypvvlkpvigswgrlxxxxxxxxxxxxxxxxkevlggfqhqlfyiqeyvekpgrdir
    vfvvgeraiaaiyrrsahwitntarggqaencplteevarlsvkaaeavgggvvavdlfe
    sergllvnevnhtmefknsvhttgvdipgeilkyawslas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc9B (B:)
    mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
    rglaaaryltalgipvvnrpevieacgdkwatsvalakaglpqpktalatdreealrlme
    afgypvvlkpvixxxxxxxxxxxxxxgfqhqlfyiqeyvekpgrdirvfvvgeraiaaiy
    raencplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdi
    pgeilkyawslas