PDB entry 1uc8

View 1uc8 on RCSB PDB site
Description: Crystal structure of a lysine biosynthesis enzyme, Lysx, from thermus thermophilus HB8
Deposited on 2003-04-09, released 2003-09-23
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.24
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uc8A (A:)
    mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
    rglaaaryltalgipvvnrpevieacgdkwatsvalakaglpqpktalatdreealrlme
    afgypvvlkpvigswgrllaxxxxxxxxxxxxxxkevlggfqhqlfyiqeyvekpgrdir
    vfvvgeraiaaiyrrsahwitntarggqaencplteevarlsvkaaeavgggvvavdlfe
    sergllvnevnhtmefknsvhttgvdipgeilkyawslas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc8A (A:)
    mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
    rglaaaryltalgipvvnrpevieacgdkwatsvalakaglpqpktalatdreealrlme
    afgypvvlkpvigxxxxxxxxxxxxxxgfqhqlfyiqeyvekpgrdirvfvvgeraiaai
    yraencplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvd
    ipgeilkyawslas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uc8B (B:)
    mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
    rglaaaryltalgipvvnrpevieacgdkwatsvalakaglpqpktalatdreealrlme
    afgypvvlkpvigswgrllaxxxxxxxxxxxxxxkevlggfqhqlfyiqeyvekpgrdir
    vfvvgeraiaaiyrrsahwitntarggqaencplteevarlsvkaaeavgggvvavdlfe
    sergllvnevnhtmefknsvhttgvdipgeilkyawslas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc8B (B:)
    mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
    rglaaaryltalgipvvnrpevieacgdkwatsvalakaglpqpktalatdreealrlme
    afgypvvlkpvixxxxxxxxxxxxgfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyra
    encplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdipg
    eilkyawslas