PDB entry 1uc7

View 1uc7 on RCSB PDB site
Description: Crystal structure of DsbDgamma
Deposited on 2003-04-09, released 2004-04-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uc7a_
  • Chain 'B':
    Domains in SCOP 1.69: d1uc7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uc7A (A:)
    taqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkal
    adtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahl
    rdrqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc7A (A:)
    aqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkala
    dtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlr
    drqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uc7B (B:)
    taqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkal
    adtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahl
    rdrqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uc7B (B:)
    aqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkala
    dtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlr
    drqp