PDB entry 1uc6

View 1uc6 on RCSB PDB site
Description: Solution Structure of the Carboxyl Terminal Domain of the Ciliary Neurotrophic Factor Receptor
Class: protein binding
Keywords: cytokine, ciliary neurotrophic factor, leukemia inhibitory factor, cytokine receptor, fibronectin type III domain-like topology, seven beta-strands, two anti-parallel beta-sheets, NMR, PROTEIN BINDING
Deposited on 2003-04-08, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ciliary Neurotrophic Factor Receptor alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26992 (5-108)
      • expression tag (0-4)
      • conflict (64)
    Domains in SCOPe 2.08: d1uc6a1, d1uc6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc6A (A:)
    gplgsvkpdppenvvarpvpsnprrlevtwqtpstwpdpesfplkfflryrplildqwqh
    velsngtahtitdayagkeyiiqvaakdneigtwsdwsvaahatpwtee