PDB entry 1uc3

View 1uc3 on RCSB PDB site
Description: Crystal Structure of hemoglobinI from river lamprey
Class: oxygen storage/transport
Keywords: globin-fold, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2003-04-08, released 2003-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3a_
  • Chain 'B':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3b_
  • Chain 'C':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3c_
  • Chain 'D':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3d_
  • Chain 'E':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3e_
  • Chain 'F':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3f_
  • Chain 'G':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3g_
  • Chain 'H':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3h_
  • Chain 'I':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3i_
  • Chain 'J':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3j_
  • Chain 'K':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3k_
  • Chain 'L':
    Compound: globin
    Species: Lampetra fluviatilis [TaxId:7748]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uc3l_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3A (A:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3B (B:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3C (C:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3D (D:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3E (E:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3F (F:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3G (G:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3H (H:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3I (I:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3J (J:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3K (K:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uc3L (L:)
    pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay