PDB entry 1uby

View 1uby on RCSB PDB site
Description: structure of farnesyl pyrophosphate synthetase
Deposited on 1996-10-14, released 1997-03-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1uby__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uby_ (-)
    spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
    aayrelsgpgqkdaeslrcalavgwcielfqaaslvaddimdqsltrrgqlcwykkegvg
    ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
    shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
    ldcfgdpaltgavgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
    eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk