PDB entry 1uby

View 1uby on RCSB PDB site
Description: structure of farnesyl pyrophosphate synthetase
Class: transferase
Keywords: transferase, isoprene biosynthesis, cholesterol biosynthesis
Deposited on 1996-10-14, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl Diphosphate Synthase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08836 (Start-366)
      • conflict (111-112)
      • conflict (270)
    Domains in SCOPe 2.07: d1ubya_
  • Heterogens: MG, DMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ubyA (A:)
    mhkftgvnakfqqpalrnlspvvverereefvgffpqivrdltedgighpevgdavarlk
    evlqynapggkcnrgltvvaayrelsgpgqkdaeslrcalavgwcielfqaaslvaddim
    dqsltrrgqlcwykkegvgldaindsfllessvyrvlkkycrqrpyyvhllelflqtayq
    telgqmldlitapvskvdlshfseerykaivkyktafysfylpvaaamymvgidskeehe
    nakaillemgeyfqiqddyldcfgdpaltgavgtdiqdnkcswlvvqclqrvtpeqrqll
    ednygrkepekvakvkelyeavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaq
    kiykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ubyA (A:)
    spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
    aayrelsgpgqkdaeslrcalavgwcielfqaaslvaddimdqsltrrgqlcwykkegvg
    ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
    shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
    ldcfgdpaltgavgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
    eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk