PDB entry 1ubs

View 1ubs on RCSB PDB site
Description: tryptophan synthase (e.c.4.2.1.20) with a mutation of lys 87->thr in the b subunit and in the presence of ligand l-serine
Class: lyase/peptide
Keywords: LYASE-PEPTIDE complex
Deposited on 1995-12-14, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: TRPA/TRPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ubsa_
  • Chain 'B':
    Compound: tryptophan synthase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: TRPA/TRPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00933
      • engineered (86)
    Domains in SCOPe 2.07: d1ubsb_
  • Heterogens: NA, SER, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ubsA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ubsA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    plhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqm
    laelrsfvsamkaasra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ubsB (B:)
    mttllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptalt
    kcqnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasa
    lasallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgs
    yetahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigm
    fadfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysi
    sagldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalk
    mmreqpekeqllvvnlsgrgdkdiftvhdilkargli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ubsB (B:)
    tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
    qnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasala
    sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
    tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
    dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
    gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
    reqpekeqllvvnlsgrgdkdiftvhdil