PDB entry 1ubp

View 1ubp on RCSB PDB site
Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution
Class: hydrolase
Keywords: urease, bacillus pasteurii, nickel, hydrolase, beta-mercaptoethanol
Deposited on 1998-01-21, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.158
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ubpa_
  • Chain 'B':
    Compound: urease
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ubpb_
  • Chain 'C':
    Compound: urease
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41020 (0-569)
      • variant (18)
      • insertion (27)
      • variant (28)
      • variant (35-37)
      • modified residue (219)
      • variant (262)
      • variant (419)
    Domains in SCOPe 2.07: d1ubpc1, d1ubpc2
  • Heterogens: NI, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ubpA (A:)
    mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ubpB (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ubpC (C:)
    mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
    trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
    viaaegkivtaggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwni
    ekmlksteglpinvgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvad
    eadvqvaihsdtlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpss
    tnptrpftvntidehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismm
    stdalamgragemvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgi
    ahevgsieegkfadlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmy
    gtvgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidin
    petyevkvdgevltcepvkelpmaqryflf