PDB entry 1ubn

View 1ubn on RCSB PDB site
Description: selenosubtilisin bpn
Class: hydrolase
Keywords: serine proteinase, hydrolase
Deposited on 1999-06-02, released 1999-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (selenosubtilisin bpn)
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (0-274)
      • see remark 999 (220)
    Domains in SCOPe 2.07: d1ubna_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ubnA (A:)
    aqsvpygvsqikapalhsqgytgsnvkvavidsgidsshpdlkvaggasmvpsetnpfqd
    nnshgthvagtvaalnnsigvlgvapsaslyavkvlgadgsgqyswiingiewaiannmd
    vinmslggpsgsaalkaavdkavasgvvvvaaagnegtsgssstvgypgkypsviavgav
    dssnqrasfssvgpeldvmapgvsiqstlpgnkygayngtcmasphvagaaalilskhpn
    wtntqvrsslentttklgdsfyygkglinvqaaaq