PDB entry 1ubg

View 1ubg on RCSB PDB site
Description: MsREcA-dATP complex
Class: recombination
Keywords: recombination, DNA-repair
Deposited on 2003-04-04, released 2003-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.222
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RecA
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ubga1, d1ubga2
  • Heterogens: DTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ubgA (A:)
    maqqapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglpr
    grvieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsq
    pdtgeqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkm
    tgalnnsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdav
    gnrtrvkvvknkvsppfkqaefdilygqgisregslidmgvehgfirksgswftyegeql
    gqgkenarkfllentdvaneiekkikeklgigavvtaeaddvlpapvdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ubgA (A:)
    maqqapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglpr
    grvieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsq
    pdtgeqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkm
    tgalnnsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdav
    gnrtrvkvvknkvsppfkqaefdilygqgisregslidmgvehgfirksgswftyegeql
    gqgkenarkfllentdvaneiekkikeklg