PDB entry 1ubf

View 1ubf on RCSB PDB site
Description: MsREcA-ATPgS complex
Class: recombination
Keywords: recombination, DNA-repair
Deposited on 2003-04-04, released 2003-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.217
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RecA
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ubfa1, d1ubfa2
  • Heterogens: AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ubfA (A:)
    maqqapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglpr
    grvieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsq
    pdtgeqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkm
    tgalnnsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdav
    gnrtrvkvvknkvsppfkqaefdilygqgisregslidmgvehgfirksgswftyegeql
    gqgkenarkfllentdvaneiekkikeklgigavvtaeaddvlpapvdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ubfA (A:)
    qapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrv
    ieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdt
    geqaleiadmlvrsgaldiividsvaalvpraeiegglqarlmsqalrkmtgalnnsgtt
    aifinqlrekitggkalkfyasvrldvrrietlkdgtdavgnrtrvkvvknkvsppfkqa
    efdilygqgisregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvane
    iekkikeklgi