PDB entry 1ube

View 1ube on RCSB PDB site
Description:
Deposited on 2003-04-04, released 2003-07-22
The last revision prior to the SCOP 1.69 freeze date was dated 2003-07-22, with a file datestamp of 2003-07-22.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.221
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ubea1, d1ubea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ubeA (A:)
    maqqapdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglpr
    grvieiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsq
    pdtgeqaleiadmlvrsgaldiividsvaalvpraeiegemgdshvglqarlmsqalrkm
    tgalnnsgttaifinqlrekigvmfgspetttggkalkfyasvrldvrrietlkdgtdav
    gnrtrvkvvknkvsppfkqaefdilygqgisregslidmgvehgfirksgswftyegeql
    gqgkenarkfllentdvaneiekkikeklgigavvtaeaddvlpapvdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ubeA (A:)
    apdrekalelamaqidknfgkgsvmrlgeevrqpisviptgsisldvalgigglprgrvi
    eiygpessgkttvalhavanaqaaggiaafidaehaldpeyakklgvdtdsllvsqpdtg
    eqaleiadmlvrsgaldiividsvaalvpraeieglqarlmsqalrkmtgalnnsgttai
    finqtggkalkfyasvrldvrrietlkdgtdavgnrtrvkvvknkvsppfkqaefdilyg
    qgisregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkike
    klg