PDB entry 1ubd

View 1ubd on RCSB PDB site
Description: co-crystal structure of human yy1 zinc finger domain bound to the adeno-associated virus p5 initiator element
Deposited on 1996-10-04, released 1996-12-23
The last revision prior to the SCOP 1.57 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ubdC (C:)
    tiacphkgctkmfrdnsamrkhlhthgprvhvcaecgkafvessklkrhqlvhtgekpfq
    ctfegcgkrfsldfnlrthvrihtgdrpyvcpfdgcnkkfaqstnlkshiltha