PDB entry 1ubd

View 1ubd on RCSB PDB site
Description: co-crystal structure of human yy1 zinc finger domain bound to the adeno-associated virus p5 initiator element
Class: transcription/DNA
Keywords: transcription initiation, initiator element, yy1, zinc finger protein, DNA- protein recognition, complex (transcription regulation/DNA), transcription/DNA complex
Deposited on 1996-10-04, released 1996-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*gp*gp*gp*tp*cp*tp*cp*cp*ap*tp*tp*tp*tp*gp*ap*a p*gp*cp*g)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*cp*gp*cp*tp*tp*cp*ap*ap*ap*ap*tp*gp*gp*ap*gp*ap*c p*cp*cp*t)-3')
  • Chain 'C':
    Compound: protein (yy1 zinc finger domain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ubdc1, d1ubdc2, d1ubdc3, d1ubdc4
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ubdC (C:)
    meprtiacphkgctkmfrdnsamrkhlhthgprvhvcaecgkafvessklkrhqlvhtge
    kpfqctfegcgkrfsldfnlrthvrihtgdrpyvcpfdgcnkkfaqstnlkshilthaka
    knnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ubdC (C:)
    tiacphkgctkmfrdnsamrkhlhthgprvhvcaecgkafvessklkrhqlvhtgekpfq
    ctfegcgkrfsldfnlrthvrihtgdrpyvcpfdgcnkkfaqstnlkshiltha